Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKG-NEAEVIQIMSTNPMHFLHPDISPGQKLKLNV 1PVE Chain:A ((30-56)) -------------------------------PALLQQIGRENPQLLQQISQHQEHFIQ-------------

General information: TITO was launched using: RESULT: Template: 1PVE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 28 -4497 -160.59 -172.94 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -160.59 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.317

(partial model without unconserved sides chains): PDB file : Tito_1PVE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PVE-query.scw PDB file : Tito_Scwrl_1PVE.pdb: