Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQPDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQYYDEKKK 1YVB Chain:I ((4-30)) --------------------------------------------------------GAPVPVDE-NDEGLQRALQFAMAEYNRA--

General information: TITO was launched using: RESULT: Template: 1YVB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 16 205 12.81 7.59 target 2D structure prediction score : 0.26 Monomeric hydrophicity matching model chain I : 0.59 3D Compatibility (PKB) : 12.81 2D Compatibility (Sec. Struct. Predict.) : 0.26 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.106

(partial model without unconserved sides chains): PDB file : Tito_1YVB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YVB-query.scw PDB file : Tito_Scwrl_1YVB.pdb: