Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNCWKTINLMKDYGAVRIILTAVCFMILVFISTFLAFELLRPGTSLSDEYVSLFGGLLVVILFVHKVIHVLPIICKKRKIEKKFYILRMRTWKRIPKTTMLISLVSPFLLITPVLFYAALAFPNHAHYFCMISGIHAGYCLPDFLLALKLIKAPKTAFIDQEADGLDILVEK 2ZXW Chain:A ((5-53)) INRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQI-------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2ZXW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 35 2282 65.20 46.57 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : 65.20 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.179

(partial model without unconserved sides chains): PDB file : Tito_2ZXW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZXW-query.scw PDB file : Tito_Scwrl_2ZXW.pdb: