Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKKSY----TELMKSRNTQKTKEFDVTMTDIYIQMVLDESLYNRRLAMLTDQINKALDEKDKDAFLTLSKEYAALKQSE 1XA6 Chain:A ((270-330)) ---KKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLY--RVSGFTEHIEDVKMAFDRDG---------------

General information: TITO was launched using: RESULT: Template: 1XA6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 90 -501 -5.57 -8.79 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -5.57 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.197

(partial model without unconserved sides chains): PDB file : Tito_1XA6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1XA6-query.scw PDB file : Tito_Scwrl_1XA6.pdb: