Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEQTPIRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLV-ELMRHLTVDDQIPEALYETVAEIFSFIYKLDESVKNKK 3C00 Chain:B ((1-82)) -----PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLD-------

General information: TITO was launched using: RESULT: Template: 3C00.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 258 -45662 -176.98 -563.72 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain B : 0.75 3D Compatibility (PKB) : -176.98 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.590

(partial model without unconserved sides chains): PDB file : Tito_3C00.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C00-query.scw PDB file : Tito_Scwrl_3C00.pdb: