Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFESEAELRRIRIALVWIAVFLLFGACGNQDTIIETDNGNSDYETPQPTSFPLEHNHFGVMEDGYIKIYEYNESRNEVKLKKEYADDELE 3KVP Chain:F ((20-61)) ---------------------------------------------PQPTSFPLEHNHFGVMEDGYIKIYEYNESRNEVKLKKEYADD---

General information: TITO was launched using: RESULT: Template: 3KVP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 111 -931 -8.39 -22.17 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain F : 0.73 3D Compatibility (PKB) : -8.39 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.574

(partial model without unconserved sides chains): PDB file : Tito_3KVP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KVP-query.scw PDB file : Tito_Scwrl_3KVP.pdb: