Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRVLFSVIVFTAVGFTFCQSKAHALTFTVLPITQKTDQWSVKVSEAKNVKEFTRPHKGEYQVYSLEVKNIGEKAATVDVQLYRNDPNSITRFSLFGCPDENCVKPKEDSKMLAESLNDGSPLKFNHFMLADKASELEVVIIWTQKGQEGRNLKQTFKFTEDGVN 3FCG Chain:A ((47-79)) -------------------------------------------------------------------------------------------------------------------------PFELANLP---GSGELKVIIH--ES--DGTKQVFTVP-------

General information: TITO was launched using: RESULT: Template: 3FCG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 40 -6255 -156.36 -208.48 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -156.36 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.399

(partial model without unconserved sides chains): PDB file : Tito_3FCG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FCG-query.scw PDB file : Tito_Scwrl_3FCG.pdb: