Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRDRGTIKWTSMMLPEHLTQLKQDLIDVSKIEKPSLDDQQIEEMDILVSEALEFNKELQFKLFHNGFVENVTGRVHYINFEQQKLHVKDQ----NDNTVYINMNNIIGVTYND 1Y96 Chain:A ((17-71)) -------------------------------------------------------YKEVRVTASEK---NEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETM-

General information: TITO was launched using: RESULT: Template: 1Y96.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 171 -9358 -54.73 -183.49 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -54.73 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.608

(partial model without unconserved sides chains): PDB file : Tito_1Y96.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y96-query.scw PDB file : Tito_Scwrl_1Y96.pdb: