Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEHAKELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR 2LV3 Chain:A ((36-111)) --EGNRVMIFSKSY-CPHSTRVK------ELFSS--------LGVVYNILELDQVDDGASVQEVLTEIS-NQKTVPNIFVNKVHVG-GCDRTFQA-------------

General information: TITO was launched using: RESULT: Template: 2LV3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 302 -33159 -109.80 -436.30 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -109.80 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.466

(partial model without unconserved sides chains): PDB file : Tito_2LV3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LV3-query.scw PDB file : Tito_Scwrl_2LV3.pdb: