Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKVLYITAHPHDEAT--SYSMATGKAFIESYKEANPNDEVVHIDLYKE--NIPHIDADVFSGWGKLQSGTGFEELSESEKAKVGRLGELSDQFASADKYVFVTPLWNFSFPPVMKAYLDSVAVAGKSFKYTEQGPVGLLTDKKAIHIQARGGYYSEGPAAEMEMGHRYIGIMMNFFGVPSFDGIFVEGHNAEPDKAQQIKEDAIARAKEAGKTF
2HPV Chain:A ((2-208))-SKLLVVKAHPLT--KEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEG-----KDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAMTKATEYGKTF


General information:
TITO was launched using:
RESULT:

Template: 2HPV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 933 1269 1.36 6.25
target 2D structure prediction score : 0.73
Monomeric hydrophicity matching model chain A : 0.86

3D Compatibility (PKB) : 1.36
2D Compatibility (Sec. Struct. Predict.) : 0.73
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.555

(partial model without unconserved sides chains):
PDB file : Tito_2HPV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HPV-query.scw
PDB file : Tito_Scwrl_2HPV.pdb: