Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAYKIDDKQDQRLVNDTLNQIDIPEGYILHSDQGSVYTSYAYYQLCEEKGIIRSMSRKGTPADNAPIESF---HSSLKSETLYINNQLNSSNHIVIDIVEKYIKNYNNNQIQQKLGYLSPVKYRELIA-----------
3EDV Chain:A ((2-323))SHMRHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR--KHYASEEIKEKLLQLTE-KRKEMIDKWEDRWEWLRL


General information:
TITO was launched using:
RESULT:

Template: 3EDV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 9670 for 658 contacts (14.7/contact) +
2D Compatibility (PS) -12487 + (NN) 2117 + (LL) 488
1D Compatibility (HY) -4400 + (ID) 1000
Total energy: -5612.0 ( -8.53 by residue)
QMean score : 0.242

(partial model without unconserved sides chains):
PDB file : Tito_3EDV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3EDV-query.scw
PDB file : Tito_Scwrl_3EDV.pdb: