Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEMGRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEELGLRLDGVINIKVDPSCLIERLSGRIINRKTGETFHKVFNPPVD-----YKEEDYYQREDDKPETVKRRLDVNIAQGEPILEHYRKLGLVTDIEGNQEITEVFADVEKALLELK
3BE4 Chain:A ((6-217))HNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNG--IGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVC-VNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIYFEIDDSEIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYEDLGILKRVNAKLPPKEVTEQIKKIL----


General information:
TITO was launched using:
RESULT:

Template: 3BE4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -66402 for 1573 contacts (-42.2/contact) +
2D Compatibility (PS) -22257 + (NN) -8781 + (LL) 820
1D Compatibility (HY) -17600 + (ID) 4350
Total energy: -118570.0 ( -75.38 by residue)
QMean score : 0.499

(partial model without unconserved sides chains):
PDB file : Tito_3BE4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3BE4-query.scw
PDB file : Tito_Scwrl_3BE4.pdb: