Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPKIGVSLIVLIMLIIFLAGCNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL 3I2Z Chain:B ((41-56)) ---------------------------------------------------------------------------------------FKTLAEGQRVEFEITN-----------------

General information: TITO was launched using: RESULT: Template: 3I2Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 -1588 -529.33 -99.25 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -529.33 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.794

(partial model without unconserved sides chains): PDB file : Tito_3I2Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3I2Z-query.scw PDB file : Tito_Scwrl_3I2Z.pdb: