Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKIAVFASANGSNFQVIAEQF-------PVSFVFSDHRDAYVLERAQNLAIPSFAFELKEFENKAAYEQAVVDLLDKHEIDLVCLAGYMKIVGETLLSAYEGRIINIHPTYLPEFPGAHGIKDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVHVPRLADDSLESFETRIHETEYQLYPAVLDSLGIKRK
1JKX Chain:A ((1-188))MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRL


General information:
TITO was launched using:
RESULT:

Template: 1JKX.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -140015 for 1445 contacts (-96.9/contact) +
2D Compatibility (PS) -20075 + (NN) -11180 + (LL) 0
1D Compatibility (HY) -14800 + (ID) 3350
Total energy: -189420.0 ( -131.09 by residue)
QMean score : 0.577

(partial model without unconserved sides chains):
PDB file : Tito_1JKX.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1JKX-query.scw
PDB file : Tito_Scwrl_1JKX.pdb: