Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSSHYKYPLIFTAFLLIAFCLIFFSYHLIHHVRLEYPNWQGESKDQNWEAVFTKNEDAPNEYSGKLYWIGDTIEIDNTYLESL--IVKKDDEVLLSSDTEIPMHDYAGGTFSDGSAKEKSVSFLERLDEHELEGHDITIEVKWKQGNHYSASQLTLNEKTLFDEKQQ 4QSL Chain:H ((800-855)) -------------------------------------------------------------------------QIINHYWEDVRHYYKDFDNALNSPQTEVYIHEMPGGQYTNLQQQAIAVGLGDRWDE--------------------------------------

General information: TITO was launched using: RESULT: Template: 4QSL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 49 684 13.95 12.66 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain H : 0.62 3D Compatibility (PKB) : 13.95 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.091

(partial model without unconserved sides chains): PDB file : Tito_4QSL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4QSL-query.scw PDB file : Tito_Scwrl_4QSL.pdb: