Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLSDNNFVSETLENVQYLLPGAKVIKLRGYSRAHKV-YTIAKSPVEKWKVAAGLSGSEIA-ILIRKGHWIGASIPAGGIVIDIDDSKQGELVKGLLDAQNFHCHCIRTLMGGSLFLRITNMGKRKLNK 3A22 Chain:A ((6-71)) ---------------QITVPSAPMGWASWNSFAAKIDYSVIKKQVDAF-VAAGLPAAGYTYINIDEGWWQGTRDSAGNITVD----------------------------------------------

General information: TITO was launched using: RESULT: Template: 3A22.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 126 -16141 -128.10 -252.20 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -128.10 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.158

(partial model without unconserved sides chains): PDB file : Tito_3A22.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3A22-query.scw PDB file : Tito_Scwrl_3A22.pdb: