Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKAWKVEPYEISKAMELIYKYLLLDKKDFSLEEFYKLTIYAIKWKLEQAQFPLYLESTKKSHQNVIPQPFKIKGNVLYKTVIKNSGDFEE 1Q2F Chain:A ((4-27)) -----------------------------SQETFSDLWKLLKKWKMRRNQFWV-------------------------------------

General information: TITO was launched using: RESULT: Template: 1Q2F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 18 -267 -14.83 -11.13 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -14.83 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.297

(partial model without unconserved sides chains): PDB file : Tito_1Q2F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q2F-query.scw PDB file : Tito_Scwrl_1Q2F.pdb: