Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSYYNKRNQEPLPKEDVSTWECTKEDCNGWTRKNFASSDTPLCPLCGSKMVDGIRSLVNLQNNSQTKTS 4AYB Chain:P ((22-35)) --------------------------------------PGVRCPYCGYKIIF-----------------

General information: TITO was launched using: RESULT: Template: 4AYB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 13 -1706 -131.23 -121.86 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain P : 0.64 3D Compatibility (PKB) : -131.23 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.851

(partial model without unconserved sides chains): PDB file : Tito_4AYB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4AYB-query.scw PDB file : Tito_Scwrl_4AYB.pdb: