Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIHPPQKNSDEGTLFLSSNLFAPPKIPSNPRTPVLLAFYRIVNITQNHTANKKRNIFSTHSLKAQTKHYKFEISWYIFLHEFSTNCIFMIEFQLS 4GEC Chain:C ((19-43)) -------------------------------------------------------------LHAQAKHGKPGLPWLVFLHGFSGDC---------

General information: TITO was launched using: RESULT: Template: 4GEC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 27 -4834 -179.04 -193.36 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain C : 0.61 3D Compatibility (PKB) : -179.04 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.219

(partial model without unconserved sides chains): PDB file : Tito_4GEC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GEC-query.scw PDB file : Tito_Scwrl_4GEC.pdb: