Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------------------------------------------------MSVLKWVSSYNNERDAWFVLYPPSKASSCFTLIV-DVALFSE---------------------------------------
4TSD Chain:A ((2-180))AIFGELSSLGHLFKKTQELEILHEYLKEVMQKGSKANQRVLNLATNTEFQVPLGHGIFSIEQSYCLEHAKESEKGFFESHKKYVDFQLIVKGVEGAKAVGINQAVIKNPYDEKRD--LIVYEPVSEASFLRLHAGMLAIFFENDAHALRFYGESFEKYREEPIFKAVVKAPKGLIKLKLAA


General information:
TITO was launched using:
RESULT:

Template: 4TSD.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -7002 for 139 contacts (-50.4/contact) +
2D Compatibility (PS) -4084 + (NN) -433 + (LL) 300
1D Compatibility (HY) -3200 + (ID) 500
Total energy: -14919.0 ( -107.33 by residue)
QMean score : 0.219

(partial model without unconserved sides chains):
PDB file : Tito_4TSD.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4TSD-query.scw
PDB file : Tito_Scwrl_4TSD.pdb: