Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
2I5M Chain:X ((1-65))MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQKVRFEIVEGNRGPQAANVTK-


General information:
TITO was launched using:
RESULT:

Template: 2I5M.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -28428 for 431 contacts (-66.0/contact) +
2D Compatibility (PS) -6257 + (NN) 1905 + (LL) 144
1D Compatibility (HY) -7200 + (ID) 2400
Total energy: -42236.0 ( -98.00 by residue)
QMean score : 0.563

(partial model without unconserved sides chains):
PDB file : Tito_2I5M.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2I5M-query.scw
PDB file : Tito_Scwrl_2I5M.pdb: