Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFNINLLNQARLESDLDSLGCLDIAEELIEKMMEDVFYSDVAQRIIVQTLAVINNANAKLQATFNILEDEDMETDERSVEFEGISYYE 2YQF Chain:A ((1465-1491)) ---------ENLYTALQSIDRGEIVNMLEGSGRQSR----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2YQF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 25 -3210 -128.40 -118.89 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -128.40 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.571

(partial model without unconserved sides chains): PDB file : Tito_2YQF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2YQF-query.scw PDB file : Tito_Scwrl_2YQF.pdb: