Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPIKKKVMMCLAVTLVFGSMSFPTLTNSGGFKESTDRNTTYIDHSPYKLSDQKKALS 2HI2 Chain:A ((6-26)) ------LMIVIAIVGILAAVALPAYQD------------------------------

General information: TITO was launched using: RESULT: Template: 2HI2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 -774 -257.83 -36.83 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -257.83 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.71 QMean score : -0.103

(partial model without unconserved sides chains): PDB file : Tito_2HI2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HI2-query.scw PDB file : Tito_Scwrl_2HI2.pdb: