Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKKETAWMKRKQLLYTEERKWEYGTILIEDGICLIENGEGDILLADSLQHSPIWIHHKGKWEQAGFQDKLVLACGAENISLSGGERIRYEKSVKRPLMAL------LDSLDDETFLAFLQHL-HSFGLSVFDCVFSYNKGVFSNTS--AGQGVSFYHFSNDTAQCAMQHHYNYSSEGTGDRFEWTASNGKRSIMYTAVQRGRK 1Y3T Chain:A ((245-334)) -----------------------------------------------------------------CLEGQMTMWTDGQEIQLNPGDFLHVPANTVHSYRLDSHYTKMVGVLVPGLFEPFFRTLGDPYEGHIFPC-KPQALRFDRILQNIEALDLKV------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1Y3T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 167 -18585 -111.28 -229.44 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -111.28 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.296

(partial model without unconserved sides chains): PDB file : Tito_1Y3T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y3T-query.scw PDB file : Tito_Scwrl_1Y3T.pdb: