Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYATMESVRLQSEAQQLAEMILQSETAENYRNCYKRLQEDEEAGRIIRSFIKIKEQYEDVQRFGKYHPDYREISRKMREIKRELDLNDKVADFKRAENE-LQSILDEVSVEIGTAVSEHVKVPTGNPYFDGLSSCGGGCGSGGSCGCKVS 1BM0 Chain:A ((478-552)) -----------------------TESLVNRRPCFSALEVDET--YVPKEF--------NAETF-TFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFA-----------------------------------------

General information: TITO was launched using: RESULT: Template: 1BM0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 103 -302 -2.93 -4.08 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -2.93 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.399

(partial model without unconserved sides chains): PDB file : Tito_1BM0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BM0-query.scw PDB file : Tito_Scwrl_1BM0.pdb: