Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSVKIIDPEGNDVTPEKLKREQRNNKLH 1NKZ Chain:B ((1-21)) -------------------ATLTAEQSEE---LHKYVIDGTRV----------------------------------

General information: TITO was launched using: RESULT: Template: 1NKZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 10 -227 -22.70 -10.81 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : -22.70 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.609

(partial model without unconserved sides chains): PDB file : Tito_1NKZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NKZ-query.scw PDB file : Tito_Scwrl_1NKZ.pdb: