Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIREHLLKEIEKKRAELLQIVMAN--GMTSHITIELSQELDHLLIQYQKQRLRAVAGDE 1WRD Chain:A ((255-305)) ---QELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFR-----

General information: TITO was launched using: RESULT: Template: 1WRD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 67 -769 -11.48 -15.69 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -11.48 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.847

(partial model without unconserved sides chains): PDB file : Tito_1WRD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WRD-query.scw PDB file : Tito_Scwrl_1WRD.pdb: