Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF 1DUL Chain:A ((37-61)) ----------------RKRRIAAGSGMQVQDVNRLLKQFDD----------------

General information: TITO was launched using: RESULT: Template: 1DUL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 40 -3204 -80.09 -128.14 target 2D structure prediction score : 0.96 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -80.09 2D Compatibility (Sec. Struct. Predict.) : 0.96 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.859

(partial model without unconserved sides chains): PDB file : Tito_1DUL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DUL-query.scw PDB file : Tito_Scwrl_1DUL.pdb: