Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEESHAVREMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDENDPDLLAKSIQQIFETSFEQTLPIASCREVAGQLLFIKNSSSCTP 1YO3 Chain:A ((23-45)) -------------------------------------LQKYNVEKDIAAHIKKEFDRKYD--------------------------

General information: TITO was launched using: RESULT: Template: 1YO3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 18 -1237 -68.69 -53.76 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -68.69 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.821

(partial model without unconserved sides chains): PDB file : Tito_1YO3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YO3-query.scw PDB file : Tito_Scwrl_1YO3.pdb: