Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKHQNPSKRLLRLSIKYLLAAAAVVLTYFAVIYILFSLAGTSYRSAAHVLLFAVVFLVLGLCFEPFERLMIHSFTFFKTGKRLFILLAGIVQLLFLWMTAHTTDQLISDIWLSTTEEMIVAAVFLILDKCNSALPS 4Q9H Chain:A ((728-780)) ----------------------------FSKVVGVFTNGGPPETQRQNSNLFSLLFLILGII--SFITFFLQGFTFGKAGEIL-----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4Q9H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 46 -10375 -225.54 -195.75 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -225.54 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.141

(partial model without unconserved sides chains): PDB file : Tito_4Q9H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4Q9H-query.scw PDB file : Tito_Scwrl_4Q9H.pdb: