Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSWAWLFAIAQFAMTWILSTVYSRRAAHFDKYVSALKEDLKGEQT 3KIK Chain:E ((6-32)) ---------------------------------------------------------------------------STIDSISNGILNNLLTTLIQDIVARET

General information: TITO was launched using: RESULT: Template: 3KIK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 7 534 76.21 19.76 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain E : 0.45 3D Compatibility (PKB) : 76.21 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.45 QMean score : 0.616

(partial model without unconserved sides chains): PDB file : Tito_3KIK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KIK-query.scw PDB file : Tito_Scwrl_3KIK.pdb: