Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQLPALT-RHFRVLRYDARGHGASSVPPGPYTLARLGEDVLELLDALEVRRAHFLGLSL-GGIVGQWLALHAPQRIERLV-LANTSAWLGPAAQWDERIAAVLQAEDMSE---TAAGFLGNWFPPAL-LERAEPV-----VERFRAMLMATNRHGLAGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTA-ASHGELIAASIAGARL-VTLPAVHLSNVEFPQAFEGAVLSFLGAA
1VA4 Chain:A ((1-269))----STFVAKDGTQIYFK-DWGSGKPVL-FSHGWLLDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLK-ATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR-


General information:
TITO was launched using:
RESULT:

Template: 1VA4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -149518 for 2230 contacts (-67.0/contact) +
2D Compatibility (PS) -26745 + (NN) -7080 + (LL) 324
1D Compatibility (HY) -18000 + (ID) 3500
Total energy: -204519.0 ( -91.71 by residue)
QMean score : 0.366

(partial model without unconserved sides chains):
PDB file : Tito_1VA4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1VA4-query.scw
PDB file : Tito_Scwrl_1VA4.pdb: