Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLP---GHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
3TQ8 Chain:A ((1-161))MIITLIAAMDKNRLIGRNNELPWHLPADLAHFKSITLGKPIVMGRRTFDSIGKPLPHRRNIVITQQKNLIIEGCDIFYSLDDALSALTKEPEVIIIGGARIFKEALPKADKMILTIINHSFEGDVYFPEWNDKEWKITSQIKHERD--NPYPFQFLELRRL-


General information:
TITO was launched using:
RESULT:

Template: 3TQ8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -121111 for 1182 contacts (-102.5/contact) +
2D Compatibility (PS) -17228 + (NN) -7750 + (LL) 232
1D Compatibility (HY) -16400 + (ID) 3300
Total energy: -165557.0 ( -140.07 by residue)
QMean score : 0.599

(partial model without unconserved sides chains):
PDB file : Tito_3TQ8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3TQ8-query.scw
PDB file : Tito_Scwrl_3TQ8.pdb: