Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKILLIGASGTLGSAVKDRLEK-KAEVITAGRHSG------------------DVTVDITSIDSIKKMYEQ----VGKVDAIVSATGSATFS---PLTELTPEKNAVTISSKLGGQINLVLLGIDSLND--KGSFTLTTGIMMEDPIVQGASAAMANGAVTAFAKSAAIEM-PRGIRINTVSPNVLEESWDKLE-----------SFFQGFVPVPAAKVARAFEKSVFGA---QTGESYKVY
2CFC Chain:A ((3-244))RVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMD


General information:
TITO was launched using:
RESULT:

Template: 2CFC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -89054 for 1677 contacts (-53.1/contact) +
2D Compatibility (PS) -20998 + (NN) -1602 + (LL) 0
1D Compatibility (HY) -5200 + (ID) 1850
Total energy: -118704.0 ( -70.78 by residue)
QMean score : 0.402

(partial model without unconserved sides chains):
PDB file : Tito_2CFC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2CFC-query.scw
PDB file : Tito_Scwrl_2CFC.pdb: