Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTGESGAAAAPSITLNDEHTMPVLGLGVAELSDDETERAVSAALEIGCRLIDTAYAYGNEAAVGRAIAASGVAREELFVTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAPPVGKYVDAWGGMIQSRGEGHARSIGVSNFTAENIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGRLLDNPTVTSIASEYVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDALGGLND-GTRVREDPLTYAGT
2WZM Chain:A ((10-283))--------AIPTVTLNDDNTLPVVGIGVGELSDSEAERSVSAALEAGYRLIDTAAAYGNEAAVGRAIAASGIPRDEIYVTTKLATPDQGFTSSQAAARASLERLGLDYVDLYLIHWPGGDTSKYVDSWGGLMKVKEDGIARSIGVCNFGAEDLETIVSLTYFTPAVNQIELHPLLNQAALREVNAGYNIVTEAYGPLGVGRLLDHPAVTAIAEAHGRTAAQVLLRWSIQLGNVVISRSANPERIASNLDVFGFELTADEMETLNGLDDGTRFR-PDPATYTGS


General information:
TITO was launched using:
RESULT:

Template: 2WZM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -133867 for 2414 contacts (-55.5/contact) +
2D Compatibility (PS) -29379 + (NN) -9272 + (LL) 380
1D Compatibility (HY) -27600 + (ID) 9000
Total energy: -208738.0 ( -86.47 by residue)
QMean score : 0.547

(partial model without unconserved sides chains):
PDB file : Tito_2WZM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2WZM-query.scw
PDB file : Tito_Scwrl_2WZM.pdb: