Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLSFLVSLVVAIVIGLIG-SAIVGNRLPGGIFGSMIAGLIG-AWIGHGLLGTWGPSLAGFAIFP-AIIGAAIFVFLLGLIFRGLRKEA 5D23 Chain:A ((127-190)) -----------RATRLKRMSEYAAKRLSSETREQRAIRLARMSAYAARRLANETPAQRQARLLRMS-------------AYAAKRQAS

General information: TITO was launched using: RESULT: Template: 5D23.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 25 -639 -25.54 -10.47 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -25.54 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.49 QMean score : -0.091

(partial model without unconserved sides chains): PDB file : Tito_5D23.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5D23-query.scw PDB file : Tito_Scwrl_5D23.pdb: