Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNIKSDRIMTSDPQKFTVDGVRFFQQYLNKIRPDAMEIDNLIINSDIIKEDLIVHVSKMIDRLALYDLHRKRSIDKHFSAAFTVDINDREEFYSANIADVSIDLNESSGV 3SP1 Chain:A ((331-405)) --------------------------HYRNQLK---FSLDNLQA-SKIARENLINKLSYFYESLDPVDLNTLNKDLKNF--GFSVE----KEYYDSFVEKISFDLNVAQGL

General information: TITO was launched using: RESULT: Template: 3SP1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 76 1635 21.51 21.79 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : 21.51 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.177

(partial model without unconserved sides chains): PDB file : Tito_3SP1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3SP1-query.scw PDB file : Tito_Scwrl_3SP1.pdb: