Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVSIFYANRLSYSIWNTIPGKYIREELEQNGVTYNELIKYWDITDPSQALPKVNKDNVLLISAKHDQYIDLKDADY---LWESWGRPTRYVYNCGHSGIVLCRKKLANDTLSFIREKLV 3W5V Chain:A ((240-291)) -------------------------------------------------------------AAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGM----EKGIDDIMVSLAEK--

General information: TITO was launched using: RESULT: Template: 3W5V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 83 -10847 -130.69 -221.37 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -130.69 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.331

(partial model without unconserved sides chains): PDB file : Tito_3W5V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3W5V-query.scw PDB file : Tito_Scwrl_3W5V.pdb: