Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence METKKEEYETKGYDTSIVYEFNEYPDARSGRCDNCDYTLFKSSVKGGKFLRECRRCGMKKNI 2D74 Chain:B ((103-136)) ---------------------------EYVICPVCGSPDTKIIKRDRFHFLKCEACGAETP-

General information: TITO was launched using: RESULT: Template: 2D74.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 102 52 0.51 1.53 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain B : 0.57 3D Compatibility (PKB) : 0.51 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.492

(partial model without unconserved sides chains): PDB file : Tito_2D74.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2D74-query.scw PDB file : Tito_Scwrl_2D74.pdb: