Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ML--GRTKLGNRNAQA-NNNAKKKNGFQT----HFDSYAGREAEKLIASNKRHND------------ 4O66 Chain:A ((10-76)) FLRGACIKTGDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPL

General information: TITO was launched using: RESULT: Template: 4O66.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 105 10250 97.61 213.53 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : 97.61 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.359

(partial model without unconserved sides chains): PDB file : Tito_4O66.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4O66-query.scw PDB file : Tito_Scwrl_4O66.pdb: