Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTINLFFLTLTIKKRFKSLEEFEREQQIEQIYDEMKESQLKHLYLTNWR 2HEP Chain:A ((1-42)) MISN------AKIARINELAAKAKAGVIT-EEEKAEQQKLRQEYLKGFR

General information: TITO was launched using: RESULT: Template: 2HEP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 62 4019 64.82 95.69 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 64.82 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.423

(partial model without unconserved sides chains): PDB file : Tito_2HEP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HEP-query.scw PDB file : Tito_Scwrl_2HEP.pdb: