Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MSVLGQQAAIGIVVHLIFIAVTWWALQAVNIDPLIKKGKVVQARLLMILLTIAIGTAVANFFLDY---LNYSQQLPYLF 1DTD Chain:B ((1-61)) DESFLCYQP--DQVCCFICR----------GAAPLPSEGECNPHP------TAPWCREGAVEWVPYSTGQCRTTCIPYV-

General information: TITO was launched using: RESULT: Template: 1DTD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 245 -25397 -103.66 -445.56 target 2D structure prediction score : 0.28 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -103.66 2D Compatibility (Sec. Struct. Predict.) : 0.28 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.225

(partial model without unconserved sides chains): PDB file : Tito_1DTD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DTD-query.scw PDB file : Tito_Scwrl_1DTD.pdb: