Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
1T12 Chain:A ((1-91))AITCGQVTSNLAPCLAYLRNTG--PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ


General information:
TITO was launched using:
RESULT:

Template: 1T12.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -51484 for 683 contacts (-75.4/contact) +
2D Compatibility (PS) -9692 + (NN) -2665 + (LL) 116
1D Compatibility (HY) -9600 + (ID) 2750
Total energy: -76075.0 ( -111.38 by residue)
QMean score : 0.569

(partial model without unconserved sides chains):
PDB file : Tito_1T12.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1T12-query.scw
PDB file : Tito_Scwrl_1T12.pdb: