Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
1XMO Chain:N ((2-61))-ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW


General information:
TITO was launched using:
RESULT:

Template: 1XMO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -28489 for 320 contacts (-89.0/contact) +
2D Compatibility (PS) -6064 + (NN) -1956 + (LL) 208
1D Compatibility (HY) -7200 + (ID) 2100
Total energy: -45601.0 ( -142.50 by residue)
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_1XMO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1XMO-query.scw
PDB file : Tito_Scwrl_1XMO.pdb: