Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSAVTWVIKHWSEFSGWINALMEKL 1NCQ Chain:D ((45-62)) ---------------------------------------------------------------LSMDPSKFTEPVKDLMLK-

General information: TITO was launched using: RESULT: Template: 1NCQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 8 1067 133.31 59.25 target 2D structure prediction score : 0.06 Monomeric hydrophicity matching model chain D : 0.41 3D Compatibility (PKB) : 133.31 2D Compatibility (Sec. Struct. Predict.) : 0.06 1D Compatibility (Hydrophobicity) : 0.41 QMean score : 0.509

(partial model without unconserved sides chains): PDB file : Tito_1NCQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NCQ-query.scw PDB file : Tito_Scwrl_1NCQ.pdb: