Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKKSYTELMKSRNTQKTKEFDVTMTDIYIQMVLDESLYNRRLAMLTDQINKALDEKDKDAFLTLSKEYAALKQSE 3DO9 Chain:A ((110-180)) ----ANYVAVLEENPYLPKHIEVNEKDRLLAERFLEESVFSFRRERLLKQIDEALDKQDKEAFHRLTAELKMLEG--

General information: TITO was launched using: RESULT: Template: 3DO9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 98 -9640 -98.36 -135.77 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -98.36 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.530

(partial model without unconserved sides chains): PDB file : Tito_3DO9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DO9-query.scw PDB file : Tito_Scwrl_3DO9.pdb: