Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILYDAIMYKYPNAVSRKDFELRNDGNGSYIEKWNLRAPLPTQAELETWWEELQKNPPYEPPDQVELLAQELSQEKLARKQLEELNKTLGNELSDIKLSLLSLKGDYAE 3C6N Chain:B ((81-134)) ------------------DFNLVPDGWGGYVYPW-----IEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKV--------------------------------

General information: TITO was launched using: RESULT: Template: 3C6N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 125 -14724 -117.79 -272.66 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : -117.79 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.305

(partial model without unconserved sides chains): PDB file : Tito_3C6N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C6N-query.scw PDB file : Tito_Scwrl_3C6N.pdb: