Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN 3IVP Chain:A ((39-64)) --------------------------------PRYLTNIENKGQHPSLQVLYDLVSLL-------

General information: TITO was launched using: RESULT: Template: 3IVP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 33 -3924 -118.89 -150.90 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -118.89 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.506

(partial model without unconserved sides chains): PDB file : Tito_3IVP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IVP-query.scw PDB file : Tito_Scwrl_3IVP.pdb: