Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEGWPKQ 5HKH Chain:A ((7-28)) ---------KITLTSDPRLPYKVLSVPESTP---------------------------------

General information: TITO was launched using: RESULT: Template: 5HKH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 22 -2606 -118.45 -118.45 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -118.45 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.353

(partial model without unconserved sides chains): PDB file : Tito_5HKH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5HKH-query.scw PDB file : Tito_Scwrl_5HKH.pdb: