Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEIAIIALFIVSIALIAFSYSQRDPMKDVEQELETLQLSAMQEIYKLKKKMTVLEEELLETNLVIRKSKQNDINQKIAKQILSKYNNGMSAEAIAKAEHVSVEDVNTIIKDNEKVLV 1TC3 Chain:C ((10-47)) ----------------------------------------------------------------------------ERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVS---

General information: TITO was launched using: RESULT: Template: 1TC3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 88 -11116 -126.32 -292.53 target 2D structure prediction score : 0.89 Monomeric hydrophicity matching model chain C : 0.51 3D Compatibility (PKB) : -126.32 2D Compatibility (Sec. Struct. Predict.) : 0.89 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.714

(partial model without unconserved sides chains): PDB file : Tito_1TC3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TC3-query.scw PDB file : Tito_Scwrl_1TC3.pdb: